Skip to main content

Advertisement

Table 3 Minimum energies for three real proteins obtained by TS and GATS algorithm using off-lattice AB model in three dimensions.

From: 3D Protein structure prediction with genetic tabu search algorithm

PDB ID SEQUENCES
1BXL GQVGRQLAIIGDDINR -15.7164 -15.8246
1EDP CSCSSLMDKECVYFCHL -12.8392 -13.7769
1AGT GVPINVSCTGSPQCIKPCKDQGMRFGKCMNRKCHCTPK -44.2656 -46.0842
  1. The PDB ID is unique identifier of a protein in the database, representing its amino acid sequences