Skip to main content

Advertisement

Table 1 Novel alternative splicing isoform candidate biomarkers for breast cancer in plasma

From: Novel alternative splicing isoform biomarkers identification from high-throughput plasma proteomics profiling of breast cancer

Peptide sequence gene transcript mode type pvalue h c Peptide
         Atlas
SWGGRPQRMGAVPGGVWSAVLMGGAR ERBB2 ENST00000269571 i18 INTRON_AS 9.48E-05 4 20 No
QTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLI(G)LLHSSVK BRCA2 ENST00000380152 E7_E11 E_E_AS 8.57E-04 1 12 No
SLWLQSQPHFCCFWLTVTFPPPLQ^THRELAQSSHAQR NTRK3 ENST00000317501 i2_E3 i_E_AS 1.22E-02 2 10 No
WGLLLALLPPGAASTQ(A)VWTWMTR ERBB2 ENST00000269571 E1_E16 E_E_AS 1.22E-02 2 10 No
LSWNHVARALTLTQSLVSSVTSGK NTRK3 ENST00000559764 i2 INTRON_AS 1.39E-02 4 13 No
CQ(G)EPYHDIRFNLMAVVPDR BAP1 ENST00000460680 E3_E9 E_E_AS 3.33E-02 9 18 No
QVLP^VGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPK PBRM1 ENST00000296302 E9_E29 E_E_AS 3.89E-02 6 14 No
DHLACW^DYDLCITCYNTKNHDHK EP300 ENST00000263253 E22_E31 E_E_AS 4.50E-02 4 11 No