Volume 7 Supplement 5

Selected articles from the International Conference on Intelligent Biology and Medicine (ICIBM 2013): Systems Biology

Open Access

Novel alternative splicing isoform biomarkers identification from high-throughput plasma proteomics profiling of breast cancer

BMC Systems Biology20137(Suppl 5):S8

https://doi.org/10.1186/1752-0509-7-S5-S8

Published: 9 December 2013

Abstract

Background

In the biopharmaceutical industry, biomarkers define molecular taxonomies of patients and diseases and serve as surrogate endpoints in early-phase drug trials. Molecular biomarkers can be much more sensitive than traditional lab tests. Discriminating disease biomarkers by traditional method such as DNA microarray has proved challenging. Alternative splicing isoform represents a new class of diagnostic biomarkers. Recent scientific evidence is demonstrating that the differentiation and quantification of individual alternative splicing isoforms could improve insights into disease diagnosis and management. Identifying and characterizing alternative splicing isoforms are essential to the study of molecular mechanisms and early detection of complex diseases such as breast cancer. However, there are limitations with traditional methods used for alternative splicing isoform determination such as transcriptome-level, low level of coverage and poor focus on alternative splicing.

Results

Therefore, we presented a peptidomics approach to searching novel alternative splicing isoforms in clinical proteomics. Our results showed that the approach has significant potential in enabling discovery of new types of high-quality alternative splicing isoform biomarkers.

Conclusions

We developed a peptidomics approach for the proteomics community to analyze, identify, and characterize alternative splicing isoforms from MS-based proteomics experiments with more coverage and exclusive focus on alternative splicing. The approach can help generate novel hypotheses on molecular risk factors and molecular mechanisms of cancer in early stage, leading to identification of potentially highly specific alternative splicing isoform biomarkers for early detection of cancer.

Introduction

A biomarker as defined by the National Cancer Institute is "a biological molecule found in blood, other body fluids, or tissues that is a sign of a normal or abnormal process, or of a condition or disease [1]." It is a characteristic that is objectively measured and evaluated as an indicator of normal biological processes, pathogenic processes, or pharmacologic responses to a therapeutic intervention [2]. The field of biomarkers has grown extensively over the past decade in many areas such as medicine, cell biology, genetics, geology and astrobiology, and ecotoxicology etc. and biomarkers are currently being studied in many academic centers and in industry.

In recent years, functional genomics studies using DNA Microarrays have been shown effective in identifying markers differentiating between breast cancer tissues and normal tissues, by measuring thousands of differentially expressed genes simultaneously [35].

However, early detection and treatment of breast cancer is still challenging. One reason is that obtaining tissue samples for microarray analysis can be still difficult. Another reason is that genes are not directly involved in any physical functions. On the contrary, the proteome, are the real functional molecules and the keys to understanding the development of cancer. Moreover, the fact that breast cancer is not a single homogeneous disease but consists of multiple disease status, each arising from a distinct molecular mechanism and having a distinct clinical progression path [6] makes the disease difficult to early detect.

Alternative splicing isoforms represent a new class of diagnostic biomarkers [7]. The chance of success with alternative splicing isoforms would be higher than the conventional approach [8, 9]. Alternative splicing occurs in 95% human genes and works by selecting specific exons and sometimes even intronic regions of the gene into mature mRNAs [10]. Alternative splicing accounts for approximately 8% of all protein isoforms which is any of several different forms of the same protein and have three types: alternative splicing, SNP, and posttranslational modification (PTM).

Recent scientific studies have shown that diseased cells may produce many types of splicing variants of common regulatory proteins, e.g., protein kinase C, 14-3-3, p53, and VGFR, which could provide novel insights into complex disease diagnosis and management, particularly in cancers [1114]. Alternative mRNA splicing is an important source of achieving molecular functional diversity. It is often regulated in a temporal or tissue-specific fashion, giving rise to different protein isoforms in different tissues or developmental states mediated by extracellular signaling mechanisms [15, 16]. Splicing regulation is a key mechanism to tune gene expression to a variety of conditions and its dysfunction may often be at the basis of the onset of genetic disease and cancer [9]. In cancer, many examples of alternative splicing isoforms were reported [1721]. For example, Julian et al. used a high-throughput reverse transcription-PCR-based system for splicing annotation to monitor the alternative splicing profiles of 600 cancer-associated genes in a panel of 21 normal and 26 cancerous breast tissues. They found that 41 alternative splicing events significantly differed in breast tumors relative to normal breast tissues and that most cancer-specific changes in splicing that disrupt known protein domains support an increase in cell proliferation or survival consistent with a functional role for alternative splicing in cancer. Compared to normal mRNA splicing events, alternative splicing mechanisms and patterns in complex diseases such as cancer can be quite complex. Finding alternative splicing isoforms or patterns of their development, therefore, have been promising in helping develop high-quality biomarkers and targets for disease management [22].

Discovering disease biomarkers in the human plasma has been met with both enthusiasm and criticisms in recent years. On one hand, it is expected that disease conditions such as cancer may be diagnosed early by analyzing complex protein mixtures in easily accessible human blood (serum or plasma), in which proteins induced by cancer may be differentially cleaved, secreted, leaked out, and therefore differentially detected from normal healthy conditions. On the other hand, the bulk of proteins circulating in human blood vary in different conditions without cancers and across different individuals, and changes in protein expressions are often diluted in the blood -- extremely challenging for biological interpretation of protein quantification changes [23, 24]. The use of alternative splicing isoforms as potential biomarkers, therefore, offers a new opportunity to use the detectability instead of quantification of biomarker peptides, for the peptides that may map to unique alternative splicing isoforms specific to cancer.

However, systematic, comprehensive, proteome-scale experimental and computational characterization of protein isoforms directly at the protein/peptide level and with exclusive focus on alternative splicing has never been reported. Compared with the "indirect" transcriptome-level characterizations such as EST sequencing[25], exon array[26], exon-exon junction array[27], and next-generation sequencing of all mRNA transcripts [28, 29], "direct" proteome-level characterization of alternative splicing isoforms can address the wide-spread concern that mRNA expressions and protein expression do not correlate well in a clinical proteomics [30, 31]. In 2010, we developed the PEPtidomics Protein Isoform Database (PEPPI [32], http://bio.informatics.iupui.edu/peppi), a database of computationally-synthesized human peptides that can identify protein isoforms derived from either alternatively spliced mRNA transcripts or SNP variations. Although the PEPPI database is the first peptidomics protein isoform database, it is not exclusive to alternative splicing and has poor coverage of alternative splicing.

Therefore, based on the PEPPI [32], we presented a new peptidomics approach to searching novel alternative splicing isoform in proteomics data and demonstrated that the approach can help researchers identify and characterize novel alternative splicing isoform from experimental proteomics data and discover diagnostic value and clinical significance.

Materials and methods

Human plasma samples

Plasma protein profiles were collected by the Hoosier Oncology Group (HOG) (Indianapolis, IN, USA). Each sample was analyzed in a single batch by mass spectrometry. In the study, 80 plasma samples were collected (40 samples collected from women with breast cancer and 40 from healthy volunteer woman who served as controls). An independent validation dataset of 80 samples which contains 40 samples collected from women diagnosed with breast cancer and 40 from healthy volunteer woman who served as controls were collected by the Hoosier Oncology Group (HOG) (Indianapolis, IN, USA) too and is comparable to the study in the demography and clinical distribution of breast cancer stages/subtypes. For example, most of patients involved in the two studies were diagnosed with an early stage breast cancer (stage I or II), fell into age group between 40 and 65, and had mean tumor size of 2.2.

Protein identification and quantification

For protein identification, Tryptic peptides were analyzed using Thermo-Fisher Scientific linear ion-trap mass spectrometer (LTQ) coupled with a Surveyor HPLC system. Peptides were eluted with a gradient from 5 to 45% Acetonitrile developed over 120 minutes and data were collected in the triple-play mode (MS Scan, zoom scan, and MS/MS scan). The acquired raw peak list data were generated by XCalibur (version 2.0) using default parameters and further analyzed by the label-free identification and quantitative algorithm using default parameters described by Higgs et al [33]. MS database searches were performed against the combined protein data set from International Protein Index and the non-redundant NCBI-nr human protein database, which totaled 22,180 protein records. Carious data processing filters for protein identification were applied to keep only peptides with the XCorr score above 1.5 for singly charged peptides, 2.5 for doubly charged peptides, and 3.5 for triply charged peptides. These XCorr scores were set according to linear discriminant analysis similar to that described in DTASelect (version 2.0) to control false-positive rate at below 5% levels.

For protein quantification, first, all extracted ion chromatograms (XICs) were aligned by retention time. Each aligned peak were matched by precursor ion, charge state, fragment ions from MS/MS data, and retention time within a one-minute window. Then, after alignment, the area-under-the-curve (AUC) for each individually aligned peak from each sample was measured, normalized, and compared for relative abundance--all as described in [33]. Here, a linear mixed model generalized from individual ANOVA (Analysis of Variance) was used to quantify protein intensities. In principle, the linear mixed model considers three types of effects when deriving protein intensities based on weighted average of quantile-normalized peptide intensities: 1) group effect, which refers to the fixed non-random effects caused by the experimental conditions or treatments that are being compared; 2) sample effect, which refers to the random effects (including those arising from sample preparations) from individual biological samples within a group; 3) replicate effect, which refers to the random effects from replicate injections from the same sample preparation.

Peptidomics approach to searching novel alternative splicing isoform in proteomics data

Our peptidomics approach to identifying novel alternative splicing isoform in proteomics data includes three steps (Figure 1): 1) building an synthetic database of alternative splicing isoforms for proteomics experiments; 2) identification, characterization of alternative splicing isoform using proteomics; and 3) validation of alternative splicing isoform.
Figure 1

A peptidomics approach to identifying novel alternative splicing isoforms in proteomics data.

Step 1: building a synthetic database of alternative splicing isoforms for proteomics experiments

Briefly, we developed the S ynthetic A lternative S plicing D atabase (SASD) [34] in three steps: 1)extracting information on gene structures of all genes in the human genome and incorporating the IPAD database [35], 2)compiling artificial splicing transcripts, and 3) translating the artificial transcripts into alternative splicing peptides.

In the first step, we use the BioMart to extract information on all human genes in the Ensemble [36] from the Homo sapiens genes dataset (GRCh37.p10) in the Ensembl Genes 71 database. We then extract information on each human gene's position, name, exon/intron coordinates, exon phase, sequences, and annotation.

In the second step, we generate artificial splicing transcript (AST), which is an exhaustive compilation of two categories of peptides. The first category is the peptides translated from all single exons and introns, and the second category is the peptides that cover all theoretically possible exon/intron junction regions of all genes in the human genome. The first category contains two types of alternative splicing: single exon(EXON_NM) and single intron (INTRON_AS). The second category contains four types of alternative splicing: intron-exon (I_E_AS, left intron retention junction), exon-intron (E_I_AS, right intron retention junction), neighboring exon-exon (E_E_NM, normal splicing junction) and non-neighboring exon-exon (E_E_AS, exon skipping junction).

In the third step, we directly use the phase to translate the sequence for the exons with the phase information in Ensemble transcript. For the exons without the phase information in Ensemble transcript, three open reading frames are used in translating into three peptides and the longest peptide crossing the splicing site is reserved as alternative splicing peptide for SASD.

Step 2: identification and characterization of alternative splicing isoform using proteomics

The most popular three types of search algorithms are 1) correlating acquired MS/MS with theoretical spectrum, counts the number of peaks in common, such as: SEQUEST [37] and X!Tandem [38], 2) modeling the extent of peptide fragmentation, then estimates the probability that an assignment is incorrect due specifically to a random match, such as Mascot [39] and OMSSA [40], and 3) De Novo Sequencing such as Lutefisk[41] and PEAKS[42]. We first run OMSSA against SASD to identify peptide from MS data. Then we perform preliminary data analysis. Last, we extract information about alternative splicing.

OMSSA reports hits ranked by E-value. An E-value for a hit is a score that is the expected number of random hits from a search library to a given spectrum, such that the random hits have an equal or better score than the hit. For example, a hit with an E-value of 1.0 implies that one hit with a score equal to or better than the hit being scored would be expected at random from a sequence library search [40]. The E-value is calculated to report the expected frequency of observing scores equivalent to or better than the one for the reported peptide if the results were to take place randomly. The lower the E-value is, the more significant the score for the identified peptide by the peptide search using SASD database is.

One-sided Wilcoxon signed-rank test is used to perform the preliminary statistical analysis in order to identify peptides with significant occurrence differences in the health and breast cancer samples.

Step 3: validation of alternative splicing isoform

We present two kinds of methods to validate isoforms in proteomics data, which are 1) literature curation of alternative splicing isoforms and 2) cross-validation of multiple studies. First, we perform an extensive literature curation to determine the constituents of alternative splicing isoform. Then, we validate results using independent proteomics datasets derived from other study. We believe that such an integrative systems approach is essential to development and validation of panel alternative splicing isoform that may withstand rigorous testing for the future steps.

Pathway analysis

Pathway analysis is performed using the following databases: Integrated Pathway Analysis Database (IPAD) (http://bioinfo.hsc.unt.edu/ipad/) [43].

Results

The 80 breast cancer plasma samples with 40 samples from women diagnosed with breast cancer and 40 from healthy volunteer women as controls were searched by OMSSA[40] against the SASD database. After OMSSA searching, preliminary statistical analysis, and alternative splicing, we identified the eight alternative splicing isoform biomarkers using the peptidomics approach to searching novel alternative splicing isoform in the proteomics data (Table 1). The peptides with E-value greater than 0.01 were filtered out. The P-value was calculated by performing one-sided Wilcoxon signed-rank test to examine the probability that the median difference between two groups of samples is greater than zero. The number of such peptide found in Health (h) and Cancer (c) samples are listed separately in the table. The tested peptides are more likely to exist in cancer samples than in healthy samples when P-value is small. Bold text is the left part of the junction and italic text is the right part. Splicing site is marked by ^ or (). '()' means the splicing site is shared by the left region and right region. For example, the second peptide QTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLI(G)LLHSSVK is a synthetic product of the ENST00000380152 in gene BRCA2 when its eighth, ninth, and tenth exons are skipped and its seventh exon is combined together with its eleventh exon. The Glycine is the shared splicing site between the seventh exon and the eleventh exon.
Table 1

Novel alternative splicing isoform candidate biomarkers for breast cancer in plasma

Peptide sequence

gene

transcript

mode

type

pvalue

h

c

Peptide

        

Atlas

SWGGRPQRMGAVPGGVWSAVLMGGAR

ERBB2

ENST00000269571

i18

INTRON_AS

9.48E-05

4

20

No

QTPKHISESLGAEVDPDMSWSSSLATPPTLSSTVLI(G)LLHSSVK

BRCA2

ENST00000380152

E7_E11

E_E_AS

8.57E-04

1

12

No

SLWLQSQPHFCCFWLTVTFPPPLQ^THRELAQSSHAQR

NTRK3

ENST00000317501

i2_E3

i_E_AS

1.22E-02

2

10

No

WGLLLALLPPGAASTQ(A)VWTWMTR

ERBB2

ENST00000269571

E1_E16

E_E_AS

1.22E-02

2

10

No

LSWNHVARALTLTQSLVSSVTSGK

NTRK3

ENST00000559764

i2

INTRON_AS

1.39E-02

4

13

No

CQ(G)EPYHDIRFNLMAVVPDR

BAP1

ENST00000460680

E3_E9

E_E_AS

3.33E-02

9

18

No

QVLP^VGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPK

PBRM1

ENST00000296302

E9_E29

E_E_AS

3.89E-02

6

14

No

DHLACW^DYDLCITCYNTKNHDHK

EP300

ENST00000263253

E22_E31

E_E_AS

4.50E-02

4

11

No

None of the eight peptides are reported to have ever been detected in the Peptide Atlas database, which contains a comprehensive catalogue of all peptides derived from published proteomics experiments. They are not found with normal splicing mechanism (Table 1).

The first sequence is a single intron alternative splicing. It was observed in 20 patient samples and 4 healthy samples. Triple play mode of the annotated Thermo-Finnegan LCQ-DECA ion-trap MS/MS spectrum is shown in Figure 2[44]. The triple play mode includes a) primary mass spectrum; b) zoom scan mass spectrum; c) MS/MS mass spectrum and d) protein identification from MS/MS). Due to space limit, the spectrums of other seven alternative splicing sequences are omitted.
Figure 2

Triple play mode spectrum of SWGGRPQRMGAVPGGVWSAVLMGGAR in patient C_024.

The eight peptides, identified by OMSSA, have significant difference in the numbers of hit samples between healthy women and breast cancers (pvalue < 0.05, Table 1). A screen shot from the UCSC genome browser [45] in the region of these peptides are also shown in Figure 3. It shows that these peptide sequences are not found in EST sequences and mRNA from Genbank and one refseq gene(Figure 3).
Figure 3

UCSC genome browser screen shot of genomic region for the novel peptide.

Table 1 shows that our peptidomics approach has significant potential in enabling discovery of new types of high-quality alternative splicing isoform biomarkers. Further literature search found that there are no any literature reports for the eight peptides. Moreover, a cross-validation found that identification of the eight peptides is supported by the independent Study which contains 40 samples collected from women diagnosed with breast cancer and 40 from healthy volunteer woman who served as controls.

Pathway analysis shows the pathways linked with the eight alternative splicing isoforms are transcription factor, signaling, cancer, and synthesis (Table 2).
Table 2

Pathway analysis for the eight alternative splicing isoforms.

PathwayID

PathwayName

Molecule

200017

p73 transcription factor network

BRCA2;EP300

200141

FOXM1 transcription factor network

EP300;BRCA2

200200

Validated targets of C-MYC transcriptional repression

EP300;ERBB2

hsa04520

Adherens junction

ERBB2;EP300

hsa05212

Pancreatic cancer

ERBB2;BRCA2

1306955

GRB7 events in ERBB2 signaling

ERBB2

1358803

Downregulation of ERRB2:ERBB3 signaling

ERBB2

168253

Host Interactions with Influenza Factors

PBRM1

168268

Virus Assembly and Release

PBRM1

168270

Fusion and Uncoating of the Influenza Virion

PBRM1

168275

Entry of Influenza Virion into Host Cell via Endocytosis

PBRM1

168303

Packaging of Eight RNA Segments

PBRM1

168330

Viral RNP Complexes in the Host Cell Nucleus

PBRM1

192814

vRNA Synthesis

PBRM1

192869

cRNA Synthesis

PBRM1

200159

ErbB receptor signaling network

ERBB2

168277

Influenza Virus Induced Apoptosis

PBRM1

168288

Fusion of the Influenza Virion to the Host Cell Endosome

PBRM1

168298

Release

PBRM1

168302

Budding

PBRM1

168336

Uncoating of the Influenza Virion

PBRM1

192905

vRNP Assembly

PBRM1

73951

Homologous recombination repair of replication-independent double-strand breaks

BRCA2

918233

TRAF3-dependent IRF activation pathway

EP300

73888

Homologous Recombination Repair

BRCA2

76003

Presynaptic phase of homologous DNA pairing and strand exchange

BRCA2

76010

Homologous DNA pairing and strand exchange

BRCA2

h_hifPathway

Hypoxia-Inducible Factor in the Cardiovascular System

EP300

h_pitx2Pathway

Multi-step Regulation of Transcription by Pitx2

EP300

h_ppargPathway

Role of PPAR-gamma Coactivators in Obesity and Thermogenesis

EP300

h_RELAPathway

Acetylation and Deacetylation of RelA in The Nucleus

EP300

hsa05200

Pathways in cancer

ERBB2;BRCA2;EP300

h_carm1Pathway

Transcription Regulation by Methyltransferase of CARM1

EP300

h_melanocytepathway

Melanocyte Development and Pigmentation Pathway

EP300

h_pelp1Pathway

Pelp1 Modulation of Estrogen Receptor Activity

EP300

h_vdrPathway

Control of Gene Expression by Vitamin D Receptor

EP300

hsa05215

Prostate cancer

ERBB2;EP300

h_il7Pathway

IL-7 Signal Transduction

EP300

168325

Viral Messenger RNA Synthesis

PBRM1

1963640

GRB2 events in ERBB2 signaling

ERBB2

419524

Fanconi Anemia pathway

BRCA2

73890

Double-Strand Break Repair

BRCA2

416572

Sema4D induced cell migration and growth-cone collapse

ERBB2

h_g2Pathway

Cell Cycle: G2/M Checkpoint

EP300

h_mef2dPathway

Role of MEF2D in T-cell Apoptosis

EP300

h_atrbrcaPathway

Role of BRCA1, BRCA2 and ATR in Cancer Susceptibility

BRCA2

h_her2Pathway

Role of ERBB2 in Signal Transduction and Oncology

EP300

h_nthiPathway

NFkB activation by Nontypeable Hemophilus influenzae

EP300

h_p53hypoxiaPathway

Hypoxia and p53 in the Cardiovascular system

EP300

h_tgfbPathway

TGF beta signaling pathway

EP300

1250196

SHC1 events in ERBB2 signaling

ERBB2

200025

Signaling events mediated by HDAC Class III

EP300

hsa03440

Homologous recombination

BRCA2

200164

Retinoic acid receptors-mediated signaling

EP300

400685

Sema4D in semaphorin signaling

ERBB2

933541

TRAF6 mediated IRF7 activation

EP300

Discussions

We described the peptidomics approach to searching novel alternative splicing isoform in proteomics data, especially artificial alternative splicing and SNP. We can use it to identify two types of common alternative splicing events: Exon Skipping and Intron Retention. Exon Skipping is an alternative splicing mechanism in which exon(s) are included or excluded from the final gene transcript leading to extended or shortened mRNA variants. And Intron Retention is an event in which an intron is retained in the final transcript. Other types of alternative splicing events such as alternative 3' splice site and 5' splice site are not included in our method but can be derived indirectly from the two basic types: exon skipping and intron retention.

The current protein sequence databases used by tandem mass spectra search engines, for example IPI, UniProt, and NCBI nr, are designed to be useful as possible to as many researchers as possible. As such, they are a less than ideal substrate for tandem mass spectra search. Protein sequence databases typically represent only "full-length" protein sequences and attempt to collapse protein variants to a single "consensus" entry. Tandem mass spectra search engines, however, chop up the protein sequence using an in-silico enzymatic digestion (such as trypsin), so full-length proteins are not needed in order to identify experimentally observed peptides; and the currently available search engines require the experimental peptides' sequences be explicitly present in the sequence database in order to identify them, so explicit sequence variants are very important. The SASD is in fact a complete peptide sequence database, which includes majority of all occurrence of alternative splicing. It also provides alternative splicing for each peptide, such as splicing mode, splicing type, splicing site, starting position, ending position, and peptide sequence.

Moreover, the current protein sequence databases and some alternative splicing database such as ASTD and EID are not ideal or enough for identifying alternative splicing isoform from tandem mass spectrometry. There are either no or very few isoform information in these databases. For example, ASTD only includes 9757 occurrences of intron isoforms and 5214 occurrences of exon isoforms. Even for Cassette exons event, the number of occurrences is only 12470[15]. In contrast, the SASD database in our method includes 11,919,779 Alternative Splicing peptides covering about 56,630 genes (ensembl gene IDs), 95,260 transcripts (ensembl transcript IDs), 1956 pathways, 6704 diseases, 5615 drugs, and 52 organs.

Its comprehensive coverage means better sensitivity in identifying novel alternative splicing isoforms than the PEPPI. And its exclusive focus on alternative splicing can definitely increase the specificity of the identification of alternative splicing.

Alternative splicing isoform biomarkers are apparently important and can serve as an alternative to traditional biomarkers. We can use quantitative information such as p-value to determine the significance of the marker. We can also use the qualitative information such as: splicing type, splicing mode, peptide sequence etc. to further analyze the alternative splicing's mechanism. We think that combination of traditional biomarkers with the alternative splicing isoform biomarkers will definitely help us better understand the treatment, diagnosis, and prognosis of cancer.

Declarations

Acknowledgements

We thank Hoosier Oncology Group for collecting breast cancer plasma samples. The proteomics study for biomarker discovery was supported by the National Cancer Institute Clinical Proteomics Technology Assessment for Cancer program (U24 CA126480). We also thank the support of Bioinformatics Program at University of North Texas Health Science Center.

Declarations

The publication costs for this article were funded by the bioinformatics program in University of North Texas Health Science Center.

This article has been published as part of BMC Systems Biology Volume 7 Supplement 5, 2013: Selected articles from the International Conference on Intelligent Biology and Medicine (ICIBM 2013): Systems Biology. The full contents of the supplement are available online at http://www.biomedcentral.com/bmcsystbiol/supplements/7/S5.

Authors’ Affiliations

(1)
Department of Academic and Institutional Resources and Technology, University of North Texas Health Science Center
(2)
Department of Forensic and Investigative Genetics, University of North Texas Health Science Center
(3)
Department of Biochemistry and Molecular Biology, IU School of Medicine
(4)
Indiana Center for Systems Biology and Personalized Medicine

References

  1. National Cancer Institute Dictionary.Google Scholar
  2. Biomarkers and surrogate endpoints: preferred definitions and conceptual framework. Clinical pharmacology and therapeutics. 2001, 69 (3): 89-95.View ArticleGoogle Scholar
  3. Hu X, Zhang Y, Zhang A, Li Y, Zhu Z, Shao Z, Zeng R, Xu LX: Comparative serum proteome analysis of human lymph node negative/positive invasive ductal carcinoma of the breast and benign breast disease controls via label-free semiquantitative shotgun technology. OMICS. 2009, 13 (4): 291-300. 10.1089/omi.2009.0016.View ArticlePubMedGoogle Scholar
  4. Zeidan BA, Cutress RI, Murray N, Coulton GR, Hastie C, Packham G, Townsend PA: Proteomic analysis of archival breast cancer serum. Cancer Genomics Proteomics. 2009, 6 (3): 141-147.PubMedGoogle Scholar
  5. Lebrecht A, Boehm D, Schmidt M, Koelbl H, Schwirz RL, Grus FH: Diagnosis of breast cancer by tear proteomic pattern. Cancer Genomics Proteomics. 2009, 6 (3): 177-182.PubMedGoogle Scholar
  6. Polyak K: Breast cancer: origins and evolution. J Clin Invest. 2007, 117 (11): 3155-3163. 10.1172/JCI33295.PubMed CentralView ArticlePubMedGoogle Scholar
  7. Roberts TK, Eugenin EA, Morgello S, Clements JE, Zink MC, Berman JW: PrPC, the cellular isoform of the human prion protein, is a novel biomarker of HIV-associated neurocognitive impairment and mediates neuroinflammation. Am J Pathol. 2010, 177 (4): 1848-1860. 10.2353/ajpath.2010.091006.PubMed CentralView ArticlePubMedGoogle Scholar
  8. Brinkman BM: Splice variants as cancer biomarkers. Clinical biochemistry. 2004, 37 (7): 584-594. 10.1016/j.clinbiochem.2004.05.015.View ArticlePubMedGoogle Scholar
  9. Garcia-Blanco MA, Baraniak AP, Lasda EL: Alternative splicing in disease and therapy. Nat Biotechnol. 2004, 22 (5): 535-546. 10.1038/nbt964.View ArticlePubMedGoogle Scholar
  10. Kornblihtt AR, Schor IE, Allo M, Dujardin G, Petrillo E, Munoz MJ: Alternative splicing: a pivotal step between eukaryotic transcription and translation. Nature reviews Molecular cell biology. 2013, 14 (3): 153-165.View ArticlePubMedGoogle Scholar
  11. Anensen N, Oyan AM, Bourdon JC, Kalland KH, Bruserud O, Gjertsen BT: A distinct p53 protein isoform signature reflects the onset of induction chemotherapy for acute myeloid leukemia. Clin Cancer Res. 2006, 12 (13): 3985-3992. 10.1158/1078-0432.CCR-05-1970.View ArticlePubMedGoogle Scholar
  12. Assender JW, Gee JM, Lewis I, Ellis IO, Robertson JF, Nicholson RI: Protein kinase C isoform expression as a predictor of disease outcome on endocrine therapy in breast cancer. J Clin Pathol. 2007, 60 (11): 1216-1221. 10.1136/jcp.2006.041616.PubMed CentralView ArticlePubMedGoogle Scholar
  13. Cressey R, Wattananupong O, Lertprasertsuke N, Vinitketkumnuen U: Alteration of protein expression pattern of vascular endothelial growth factor(VEGF) from soluble to cell-associated isoform during tumourigenesis. BMC Cancer. 2005, 5: 128-10.1186/1471-2407-5-128.PubMed CentralView ArticlePubMedGoogle Scholar
  14. Di Fede G, Giaccone G, Limido L, Mangieri M, Suardi S, Puoti G, Morbin M, Mazzoleni G, Ghetti B, Tagliavini F: The epsilon isoform of 14-3-3 protein is a component of the prion protein amyloid deposits of Gerstmann-Straussler-Scheinker disease. J Neuropathol Exp Neurol. 2007, 66 (2): 124-130. 10.1097/nen.0b013e3180302060.View ArticlePubMedGoogle Scholar
  15. Thanaraj TA, Stamm S, Clark F, Riethoven JJ, Le Texier V, Muilu J: ASD: the Alternative Splicing Database. Nucleic Acids Res. 2004, 32 (Database): D64-69.PubMed CentralView ArticlePubMedGoogle Scholar
  16. Matter N, Herrlich P, Konig H: Signal-dependent regulation of splicing via phosphorylation of Sam68. Nature. 2002, 420 (6916): 691-695. 10.1038/nature01153.View ArticlePubMedGoogle Scholar
  17. Lixia M, Zhijian C, Chao S, Chaojiang G, Congyi Z: Alternative splicing of breast cancer associated gene BRCA1 from breast cancer cell line. J Biochem Mol Biol. 2007, 40 (1): 15-21. 10.5483/BMBRep.2007.40.1.015.View ArticlePubMedGoogle Scholar
  18. Zhu Z, Xing S, Cheng P, Zeng F, Lu G: Modification of alternative splicing of Bcl-x pre-mRNA in bladder cancer cells. J Huazhong Univ Sci Technolog Med Sci. 2006, 26 (2): 213-216. 10.1007/BF02895819.View ArticlePubMedGoogle Scholar
  19. Ku TH, Hsu FR: Mining colon cancer specific alternative splicing in EST database. AMIA Annu Symp Proc. 2005, 1012-Google Scholar
  20. Ogawa T, Shiga K, Hashimoto S, Kobayashi T, Horii A, Furukawa T: APAF-1-ALT, a novel alternative splicing form of APAF-1, potentially causes impeded ability of undergoing DNA damage-induced apoptosis in the LNCaP human prostate cancer cell line. Biochem Biophys Res Commun. 2003, 306 (2): 537-543. 10.1016/S0006-291X(03)00995-1.View ArticlePubMedGoogle Scholar
  21. Venables JP, Klinck R, Bramard A, Inkel L, Dufresne-Martin G, Koh C, Gervais-Bird J, Lapointe E, Froehlich U, Durand M, et al: Identification of alternative splicing markers for breast cancer. Cancer Res. 2008, 68 (22): 9525-9531. 10.1158/0008-5472.CAN-08-1769.View ArticlePubMedGoogle Scholar
  22. Skotheim RI, Nees M: Alternative splicing in cancer: noise, functional, or systematic?. Int J Biochem Cell Biol. 2007, 39 (7-8): 1432-1449. 10.1016/j.biocel.2007.02.016.View ArticlePubMedGoogle Scholar
  23. Rifai N, Gillette MA, Carr SA: Protein biomarker discovery and validation: the long and uncertain path to clinical utility. Nat Biotechnol. 2006, 24 (8): 971-983. 10.1038/nbt1235.View ArticlePubMedGoogle Scholar
  24. Kulasingam V, Diamandis EP: Strategies for discovering novel cancer biomarkers through utilization of emerging technologies. Nature clinical practice Oncology. 2008, 5 (10): 588-599. 10.1038/ncponc1187.View ArticlePubMedGoogle Scholar
  25. Adams MD, Kelley JM, Gocayne JD, Dubnick M, Polymeropoulos MH, Xiao H, Merril CR, Wu A, Olde B, Moreno RF: Complementary DNA sequencing: expressed sequence tags and human genome project. Science. 1991, 252 (5013): 1651-1656. 10.1126/science.2047873.View ArticlePubMedGoogle Scholar
  26. Kapur K, Xing Y, Ouyang Z, Wong WH: Exon arrays provide accurate assessments of gene expression. Genome Biol. 2007, 8 (5): R82-10.1186/gb-2007-8-5-r82.PubMed CentralView ArticlePubMedGoogle Scholar
  27. Johnson JM, Castle J, Garrett-Engele P, Kan Z, Loerch PM, Armour CD, Santos R, Schadt EE, Stoughton R, Shoemaker DD: Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays. Science. 2003, 302 (5653): 2141-2144. 10.1126/science.1090100.View ArticlePubMedGoogle Scholar
  28. Pan Q, Shai O, Lee LJ, Frey BJ, Blencowe BJ: Deep surveying of alternative splicing complexity in the human transcriptome by high-throughput sequencing. Nat Genet. 2008, 40 (12): 1413-1415. 10.1038/ng.259.View ArticlePubMedGoogle Scholar
  29. Pando MP, Kotraiah V, McGowan K, Bracco L, Einstein R: Alternative isoform discrimination by the next generation of expression profiling microarrays. Expert Opin Ther Targets. 2006, 10 (4): 613-625. 10.1517/14728222.10.4.613.View ArticlePubMedGoogle Scholar
  30. Lee PS, Shaw LB, Choe LH, Mehra A, Hatzimanikatis V, Lee KH: Insights into the relation between mrna and protein expression patterns: II. Experimental observations in Escherichia coli. Biotechnol Bioeng. 2003, 84 (7): 834-841. 10.1002/bit.10841.View ArticlePubMedGoogle Scholar
  31. Mehra A, Lee KH, Hatzimanikatis V: Insights into the relation between mRNA and protein expression patterns: I. Theoretical considerations. Biotechnol Bioeng. 2003, 84 (7): 822-833. 10.1002/bit.10860.View ArticlePubMedGoogle Scholar
  32. Zhou A, Zhang F, Chen JY: PEPPI: a peptidomic database of human protein isoforms for proteomics experiments. BMC bioinformatics. 2010, S7-11 Suppl 6Google Scholar
  33. Higgs RE, Knierman MD, Gelfanova V, Butler JP, Hale JE: Comprehensive label-free method for the relative quantification of proteins from biological samples. J Proteome Res. 2005, 4 (4): 1442-1450. 10.1021/pr050109b.View ArticlePubMedGoogle Scholar
  34. Zhang F, Drabier R: SASD: the Synthetic Alternative Splicing Database for identifying novel isoform from proteomics. BMC bioinformatics. 2013, S13-14 Suppl 14Google Scholar
  35. Zhang F, Drabier R: IPAD: the Integrated Pathway Analysis Database for Systematic Enrichment Analysis. BMC bioinformatics. 2012, S7-13 Suppl 15Google Scholar
  36. Flicek P, Ahmed I, Amode MR, Barrell D, Beal K, Brent S, Carvalho-Silva D, Clapham P, Coates G, Fairley S, et al: Ensembl 2013. Nucleic Acids Res. 2013, 41 (Database): D48-55.PubMed CentralView ArticlePubMedGoogle Scholar
  37. Eng JK, McCormack AL, Yates Iii JR: An approach to correlate tandem mass spectral data of peptides with amino acid sequences in a protein database. Journal of the American Society for Mass Spectrometry. 1994, 5 (11): 976-989. 10.1016/1044-0305(94)80016-2.View ArticlePubMedGoogle Scholar
  38. Bjornson RD, Carriero NJ, Colangelo C, Shifman M, Cheung KH, Miller PL, Williams K: X!!Tandem, an improved method for running X!tandem in parallel on collections of commodity computers. J Proteome Res. 2008, 7 (1): 293-299. 10.1021/pr0701198.View ArticlePubMedGoogle Scholar
  39. Koenig T, Menze BH, Kirchner M, Monigatti F, Parker KC, Patterson T, Steen JJ, Hamprecht FA, Steen H: Robust prediction of the MASCOT score for an improved quality assessment in mass spectrometric proteomics. J Proteome Res. 2008, 7 (9): 3708-3717. 10.1021/pr700859x.View ArticlePubMedGoogle Scholar
  40. Geer LY, Markey SP, Kowalak JA, Wagner L, Xu M, Maynard DM, Yang X, Shi W, Bryant SH: Open mass spectrometry search algorithm. J Proteome Res. 2004, 3 (5): 958-964. 10.1021/pr0499491.View ArticlePubMedGoogle Scholar
  41. Johnson RS, Taylor JA: Searching sequence databases via de novo peptide sequencing by tandem mass spectrometry. Mol Biotechnol. 2002, 22 (3): 301-315. 10.1385/MB:22:3:301.View ArticlePubMedGoogle Scholar
  42. Ma B, Zhang K, Hendrie C, Liang C, Li M, Doherty-Kirby A, Lajoie G: PEAKS: powerful software for peptide de novo sequencing by tandem mass spectrometry. Rapid Commun Mass Spectrom. 2003, 17 (20): 2337-2342. 10.1002/rcm.1196.View ArticlePubMedGoogle Scholar
  43. Zhang F, Drabier R: IPAD: the Integrated Pathway Analysis Database for Systematic Enrichment Analysis. BMC Bioinformatics. 2012, 13 (14):Google Scholar
  44. Wang M, Witzmann FA, Lyubimov AV: Proteomics in Drug Discovery and Development. Encyclopedia of Drug Metabolism and Interactions. 2011, John Wiley & Sons, IncGoogle Scholar
  45. Kent WJ, Sugnet CW, Furey TS, Roskin KM, Pringle TH, Zahler AM, Haussler D: The human genome browser at UCSC. Genome Res. 2002, 12 (6): 996-1006.PubMed CentralView ArticlePubMedGoogle Scholar

Copyright

© Zhang et al.; licensee BioMed Central Ltd. 2013

This article is published under license to BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.